DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and CG9287

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_609244.1 Gene:CG9287 / 34194 FlyBaseID:FBgn0032057 Length:625 Species:Drosophila melanogaster


Alignment Length:76 Identity:18/76 - (23%)
Similarity:31/76 - (40%) Gaps:27/76 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FDKSNNTDVEVETLDAKIQGQRCNCDKLLLSTEPPVPVVYFDKNYIGNVSSETILNTIEFLE-SF 190
            :|:..:|.||:.|| ..|||:       :|.|                  :.|....::|:: .:
  Fly    28 YDEEKDTIVELPTL-GSIQGK-------ILET------------------AWTKREVLQFVDVRY 66

  Fly   191 LPPPTKKHKRK 201
            ..|||..|:.|
  Fly    67 AEPPTGLHRFK 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
CG9287NP_609244.1 COesterase 33..558 CDD:395084 17/71 (24%)

Return to query results.
Submit another query.