DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Ces5a

DIOPT Version :9

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001012056.2 Gene:Ces5a / 307660 RGDID:1549717 Length:575 Species:Rattus norvegicus


Alignment Length:231 Identity:47/231 - (20%)
Similarity:75/231 - (32%) Gaps:90/231 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IALHILPLFLAIFLFTMGEAYLKSVRVDEIPFAGRKALANRRSSGIHLISSLEHQRTFLHLFHVP 71
            :.|||.|.::.|    :.:.|          |.|:.:|.:.|.             |.|.||...
  Rat   373 VLLHIPPQYMHI----VAKDY----------FHGKHSLTDIRD-------------TLLDLFGDV 410

  Fly    72 YIICFYAAKGKWPYVPGFMKYRVDNAARSFFNQNDSFIKQFCTKWIQVKECF---RPLFDKSNNT 133
            :.:           |||.:..|         |..|:....:..::.....||   ||.|.|:::|
  Rat   411 FFV-----------VPGLVTAR---------NHRDAGGPVYFYEFQHRPNCFQNTRPAFVKADHT 455

  Fly   134 D-----------------VEVETLDAKIQGQRC-------------NCDKLLLSTEPPVPVVYFD 168
            |                 .|..|.|.|:..::.             |.|.|     |..|....:
  Rat   456 DEIRFVFGGPFLEGDVVMFEEATEDEKLLSRKMMSYWANFARSGDPNGDDL-----PLWPAYDQN 515

  Fly   169 KNYIG---NVSSETIL--NTIEFLESFLPPPTKKHK 199
            ::|:.   |:|:...|  ..:||....||..|...|
  Rat   516 ESYLKLDVNISTGWRLKDRRVEFWTDTLPLITSASK 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Ces5aNP_001012056.2 Esterase_lipase 40..529 CDD:238191 40/207 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.