powered by:
Protein Alignment CG30095 and CES4A
DIOPT Version :9
Sequence 1: | NP_725529.1 |
Gene: | CG30095 / 246453 |
FlyBaseID: | FBgn0050095 |
Length: | 214 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011521323.1 |
Gene: | CES4A / 283848 |
HGNCID: | 26741 |
Length: | 628 |
Species: | Homo sapiens |
Alignment Length: | 109 |
Identity: | 23/109 - (21%) |
Similarity: | 36/109 - (33%) |
Gaps: | 47/109 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 VPYIICFYAAKGKW--PYVPGFMKYRVDNAARSFFNQNDSFIKQFCTKWIQVKECFRPLFDKSNN 132
|||::.....:..| ||: ||: || |.
Human 410 VPYLLGVNNLEFNWLLPYI---MKF--------------------------------PL----NR 435
Fly 133 TDVEVETLDAKIQGQRCNCDKLLLSTEPPVPVVYFDKNYIGNVS 176
..:..||:...:...| .||..|:..||:|. :.|:.||:
Human 436 QAMRKETITKMLWSTR----TLLNITKEQVPLVV--EEYLDNVN 473
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG30095 | NP_725529.1 |
None |
CES4A | XP_011521323.1 |
COesterase |
46..613 |
CDD:278561 |
23/109 (21%) |
Aes |
<184..>291 |
CDD:223730 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1516 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.