DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Ces2c

DIOPT Version :9

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_663578.1 Gene:Ces2c / 234671 MGIID:2385905 Length:561 Species:Mus musculus


Alignment Length:91 Identity:21/91 - (23%)
Similarity:30/91 - (32%) Gaps:38/91 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PLFLAIFLFTMGEAYLKSVR--------VDEIPFA------GRK-------ALANRR-------- 48
            |::  .:.|....:|.|.||        .|||||.      |.|       .|.:||        
Mouse   434 PVY--FYEFQHPPSYFKDVRPPHVKADHADEIPFVFASFFWGMKLDFTEEEELLSRRMMKYWANF 496

  Fly    49 -------SSGIHLISSLEHQRTFLHL 67
                   |.|:.....::|...:|.|
Mouse   497 ARHGNPNSEGLPYWPVMDHDEQYLQL 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Ces2cNP_663578.1 COesterase 31..540 CDD:278561 21/91 (23%)
Aes <130..>233 CDD:223730
Prevents secretion from ER. /evidence=ECO:0000255 558..561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.