DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Ces2b

DIOPT Version :9

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_937814.1 Gene:Ces2b / 234669 MGIID:2448547 Length:556 Species:Mus musculus


Alignment Length:130 Identity:29/130 - (22%)
Similarity:43/130 - (33%) Gaps:43/130 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 HLISSLEHQR-TFL---HLFHVPYIICFYAAKGKWPYVPG-------FMKYRVDNAARSFFNQND 106
            |.|:||:..| |.:   |...:|::..::....|..:..|       .|||..:.|...  |.|.
Mouse   437 HQIASLKDVRPTHVKADHADEIPFVFGYFFWDMKLDFTEGEKLLSRRMMKYWANFARHG--NPNS 499

  Fly   107 SFIKQFCTKWIQVKECFRPLFD------------------KSNNTDVEVETLDAKIQGQRCNCDK 153
            ..:..    |        |:.|                  ||.......:||..|||..|.:.||
Mouse   500 EGLPY----W--------PVMDHDEQYLQLDTQPAVGRALKSRRLQFWTKTLSQKIQELRASQDK 552

  Fly   154  153
            Mouse   553  552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Ces2bNP_937814.1 COesterase 34..535 CDD:365897 21/111 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.