DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Ces1f

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_659179.1 Gene:Ces1f / 234564 MGIID:2142687 Length:561 Species:Mus musculus


Alignment Length:69 Identity:16/69 - (23%)
Similarity:28/69 - (40%) Gaps:11/69 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IQGQRCNCDKLLLSTEPPVPV------VYFDKN-----YIGNVSSETILNTIEFLESFLPPPTKK 197
            :||...|.|:.:.|....|.:      :..:||     ||..::.:.....:..:..|||...|.
Mouse   307 LQGDTKNSDQFVTSVLDGVVLPKDPKEILAEKNFNTVPYIVGINKQECGWLLPTMTGFLPADVKL 371

  Fly   198 HKRK 201
            .|:|
Mouse   372 DKKK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Ces1fNP_659179.1 COesterase 22..545 CDD:395084 16/69 (23%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 558..561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.