DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and NLGN1

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001352852.1 Gene:NLGN1 / 22871 HGNCID:14291 Length:843 Species:Homo sapiens


Alignment Length:113 Identity:30/113 - (26%)
Similarity:45/113 - (39%) Gaps:24/113 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 NQNDSFIKQFCTKWIQVKE---CFRPLFDKSNNTDV-----EVETLDAKIQGQRCNCDKLLLSTE 159
            |.||  |.|:.:...:|..   .|||  .:.|:..|     ..:..|.|.|....:.|:...|||
Human   635 NLND--ISQYTSTTTKVPSTDITFRP--TRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTE 695

  Fly   160 PPVPVVYFDKNYIGNVSSETILNTIEFLESFLPPPTKKHKRKNRVRGR 207
            ..|.:.      :|  :|...||.:.|...:.    ||.||::.|..|
Human   696 LSVTIA------VG--ASLLFLNILAFAALYY----KKDKRRHDVHRR 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
NLGN1NP_001352852.1 COesterase 52..626 CDD:395084
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.