DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Nlgn2

DIOPT Version :9

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001351066.1 Gene:Nlgn2 / 216856 MGIID:2681835 Length:836 Species:Mus musculus


Alignment Length:147 Identity:32/147 - (21%)
Similarity:52/147 - (35%) Gaps:44/147 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AKGKWP--YVPGFMKYRVDNAARSFFNQNDSFIKQFCTKWIQVKECFRPLFDKSNN--------- 132
            |...|.  |.|  :||....||:...::.||.....|.:    ::..|.|.|:...         
Mouse   294 AISSWSVNYQP--LKYTRLLAAKVGCDREDSTEAVECLR----RKSSRELVDQDVQPARYHIAFG 352

  Fly   133 --TDVEVETLDAKI---QGQRCNCDKLL--------------LSTEPPVPVVYFD---KNYIGNV 175
              .|.:|...|.:|   ||:..|.|.|:              ..:|..|....||   .|::.|:
Mouse   353 PVVDGDVVPDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNL 417

  Fly   176 -----SSETILNTIEFL 187
                 ..:.:..||:|:
Mouse   418 YGYPEGKDVLRETIKFM 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Nlgn2NP_001351066.1 COesterase 42..601 CDD:306613 32/147 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..661
Required for interaction with LHFPL4. /evidence=ECO:0000269|PubMed:28279354 679..699
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 711..735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..836
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.