DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Ces2e

DIOPT Version :9

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001093947.1 Gene:Ces2e / 192257 RGDID:621563 Length:557 Species:Rattus norvegicus


Alignment Length:83 Identity:16/83 - (19%)
Similarity:28/83 - (33%) Gaps:28/83 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLFTMGEAYLKSVRVDEIPFA-------------------GRKAL---------ANRRSSGIHLI 55
            ||..:...::|:...||:|:.                   .||.:         .|..|.|:...
  Rat   442 FLKDIRPPHVKADHGDELPYVIGYLFWDMKFVFTEEEKLLSRKMIKYWANFARHGNPNSEGLPYW 506

  Fly    56 SSLEHQRTFLHLFHVPYI 73
            .:|:|...:|.|...|.:
  Rat   507 PALDHDEQYLQLDIQPVV 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Ces2eNP_001093947.1 COesterase 30..536 CDD:278561 16/83 (19%)
Aes <127..>230 CDD:223730
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.