DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and cest-31

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_504692.3 Gene:cest-31 / 187304 WormBaseID:WBGene00019653 Length:541 Species:Caenorhabditis elegans


Alignment Length:40 Identity:13/40 - (32%)
Similarity:16/40 - (40%) Gaps:10/40 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FDKSNNTDVEVETLDAKIQGQRCNCDKLLLSTEPPVPVVY 166
            |.|..:.||..||.|....|.||          ||..::|
 Worm    54 FKKPVSADVWTETRDCTKYGPRC----------PPSGMLY 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
cest-31NP_504692.3 COesterase 16..522 CDD:395084 13/40 (33%)

Return to query results.
Submit another query.