powered by:
Protein Alignment CG30095 and cest-31
DIOPT Version :9
Sequence 1: | NP_725529.1 |
Gene: | CG30095 / 246453 |
FlyBaseID: | FBgn0050095 |
Length: | 214 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_504692.3 |
Gene: | cest-31 / 187304 |
WormBaseID: | WBGene00019653 |
Length: | 541 |
Species: | Caenorhabditis elegans |
Alignment Length: | 40 |
Identity: | 13/40 - (32%) |
Similarity: | 16/40 - (40%) |
Gaps: | 10/40 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 FDKSNNTDVEVETLDAKIQGQRCNCDKLLLSTEPPVPVVY 166
|.|..:.||..||.|....|.|| ||..::|
Worm 54 FKKPVSADVWTETRDCTKYGPRC----------PPSGMLY 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG30095 | NP_725529.1 |
None |
cest-31 | NP_504692.3 |
COesterase |
16..522 |
CDD:278561 |
13/40 (33%) |
Aes |
<112..>211 |
CDD:223730 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1516 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.