powered by:
Protein Alignment CG30095 and cest-19
DIOPT Version :9
Sequence 1: | NP_725529.1 |
Gene: | CG30095 / 246453 |
FlyBaseID: | FBgn0050095 |
Length: | 214 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509187.4 |
Gene: | cest-19 / 180973 |
WormBaseID: | WBGene00020125 |
Length: | 607 |
Species: | Caenorhabditis elegans |
Alignment Length: | 122 |
Identity: | 25/122 - (20%) |
Similarity: | 47/122 - (38%) |
Gaps: | 44/122 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 PGFMKYRVDNAARSFFNQNDSF-IKQFCTKWIQVKECFRPLFDKSNNTDVEVETLDAKIQGQRCN 150
||.::....||. :|.||.| .:.|.:. ::.:|.| |.:..:: .|.:|.:
Worm 251 PGVVRNTQVNAT---WNMNDRFGCRAFNSS--ELLDCAR----KRSKEEI--------FQYKRLH 298
Fly 151 CDKLLLSTEPPVPVVYFDKNYIGNVSSETILNTIEFLESFLPPPTKK---HKRKNRV 204
.| ..|..||:: :.:|.: ||.|.:: |:||..:
Worm 299 FD----DYEEFVPII----DGVGGI---------------LPEPPEQLTLHRRKTPI 332
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG30095 | NP_725529.1 |
None |
cest-19 | NP_509187.4 |
Abhydrolase |
27..544 |
CDD:389770 |
25/122 (20%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1516 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.