DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and cest-1.2

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_506504.2 Gene:cest-1.2 / 179914 WormBaseID:WBGene00011364 Length:676 Species:Caenorhabditis elegans


Alignment Length:94 Identity:17/94 - (18%)
Similarity:32/94 - (34%) Gaps:38/94 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VDNAARSFFNQNDSFIKQFCTK-WIQVKECFRPLFDKSNNTDVEVETLDAKIQGQRCNCDKLLLS 157
            :.|:..|.|...::|:|..|.: .|::.:              |.|...:|.|            
 Worm   354 ISNSNYSKFETKETFLKNLCDQIGIEIYK--------------ESEDFSSKCQ------------ 392

  Fly   158 TEPPVPVVYFDKNYIGNVSSETILNTIEF 186
                       |.||....|:::.:.:||
 Worm   393 -----------KWYINGSDSKSLSDDMEF 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
cest-1.2NP_506504.2 COesterase 18..536 CDD:395084 17/94 (18%)

Return to query results.
Submit another query.