DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Ces3b

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_653094.2 Gene:Ces3b / 13909 MGIID:3644960 Length:571 Species:Mus musculus


Alignment Length:134 Identity:29/134 - (21%)
Similarity:45/134 - (33%) Gaps:40/134 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPLFLAIFLFTMGEAYLKSVRV-DEIPFAGRKALANRRSSGIHLISSLEHQRTFLHLFHV----- 70
            :|..|.:.....|...|||:.: |::....|:.|             ||..|.||.:..|     
Mouse   337 VPYLLGVTNHEFGWLLLKSLNILDKLEHLSREDL-------------LEISRPFLAIMEVPPEIM 388

  Fly    71 PYIICFYAAKG------KWPY----------VP--GFMKYRVDNAARSF---FNQNDSFIKQFCT 114
            |.:|..|...|      ::.:          :|  .|.||..|.....|   |....|...:|..
Mouse   389 PTVIDEYLDNGSDQSATRYAFQELLGDISFIIPTLNFSKYLRDAGCPVFLYEFQHTPSSFAKFKP 453

  Fly   115 KWIQ 118
            .|::
Mouse   454 AWVK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Ces3bNP_653094.2 COesterase 36..547 CDD:395084 29/134 (22%)
Prevents secretion from ER. /evidence=ECO:0000255 568..571
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.