DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Ces3b

DIOPT Version :9

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_653094.2 Gene:Ces3b / 13909 MGIID:3644960 Length:571 Species:Mus musculus


Alignment Length:134 Identity:29/134 - (21%)
Similarity:45/134 - (33%) Gaps:40/134 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPLFLAIFLFTMGEAYLKSVRV-DEIPFAGRKALANRRSSGIHLISSLEHQRTFLHLFHV----- 70
            :|..|.:.....|...|||:.: |::....|:.|             ||..|.||.:..|     
Mouse   337 VPYLLGVTNHEFGWLLLKSLNILDKLEHLSREDL-------------LEISRPFLAIMEVPPEIM 388

  Fly    71 PYIICFYAAKG------KWPY----------VP--GFMKYRVDNAARSF---FNQNDSFIKQFCT 114
            |.:|..|...|      ::.:          :|  .|.||..|.....|   |....|...:|..
Mouse   389 PTVIDEYLDNGSDQSATRYAFQELLGDISFIIPTLNFSKYLRDAGCPVFLYEFQHTPSSFAKFKP 453

  Fly   115 KWIQ 118
            .|::
Mouse   454 AWVK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Ces3bNP_653094.2 COesterase 36..547 CDD:278561 29/134 (22%)
Aes 75..>245 CDD:223730
Prevents secretion from ER. /evidence=ECO:0000255 568..571
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.