DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Ces1e

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_598421.1 Gene:Ces1e / 13897 MGIID:95432 Length:562 Species:Mus musculus


Alignment Length:126 Identity:27/126 - (21%)
Similarity:47/126 - (37%) Gaps:17/126 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VPYIICFYAAKGKWPYVPGFMKY-----RVDNAARSFFNQNDSFIKQFCTKWIQVKECFRPLFDK 129
            ||||:.....:..| .:|..|.|     ::|........:..||:.......|.| ...:.|.||
Mouse   344 VPYIVGINKQEFGW-ILPTMMNYPPSDVKLDQMTAMSLLKKSSFLLNLPEDAIAV-AIEKYLRDK 406

  Fly   130 ---SNNTDVEVETLDAKIQGQRCNCDKLLLS---TEPPVPVVYFDKNYIGNVSSETILNTI 184
               ..|.|..:|.:...:.|    ...:::|   .:...|...::..|..:.|||...:|:
Mouse   407 DYTGRNKDQLLELIGDVVFG----VPSVIVSRGHRDAGAPTYMYEFQYSPSFSSEMKPDTV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Ces1eNP_598421.1 COesterase 23..546 CDD:395084 27/126 (21%)
Prevents secretion from ER. /evidence=ECO:0000255 559..562
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.