DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Ces1c

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_031980.2 Gene:Ces1c / 13884 MGIID:95420 Length:554 Species:Mus musculus


Alignment Length:81 Identity:21/81 - (25%)
Similarity:30/81 - (37%) Gaps:23/81 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 WIQVKECFRPLFDKSNNTDVEVETLDAKIQGQRCNCDKLLLSTEPPVPV---VYFDKNYIGNVSS 177
            |..:..|  |:...|....| |:|...|:.|:..:    |...|.||.|   |.|.|..:|::  
Mouse     8 WASLAVC--PILGHSLLPPV-VDTTQGKVLGKYIS----LEGFEQPVAVFLGVPFAKPPLGSL-- 63

  Fly   178 ETILNTIEFLESFLPP 193
                       .|.||
Mouse    64 -----------RFAPP 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Ces1cNP_031980.2 Esterase_lipase 25..525 CDD:238191 17/62 (27%)
Prevents secretion from ER. /evidence=ECO:0000255 551..554
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.