DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and LOC1276426

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_315770.5 Gene:LOC1276426 / 1276426 VectorBaseID:AGAMI1_000772 Length:579 Species:Anopheles gambiae


Alignment Length:99 Identity:22/99 - (22%)
Similarity:39/99 - (39%) Gaps:32/99 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 FRPLFDKSNNTDVEVE-TLDAKIQGQRCNCDKLLLSTE--PPVPVVYFDKNYIGNVSSETIL--- 181
            |||:.::.:...:.:: .|||             |.||  ||:|::      .|..|.|.::   
Mosquito   316 FRPVIERPHPGAIVLQHPLDA-------------LQTELDPPIPLI------TGCNSGEGMIALA 361

  Fly   182 ----NTIEF---LESFLPPPTKKHKRKNRVRGRV 208
                :..|:   .|..|||..:.....|.:..:|
Mosquito   362 KAQHHLAEYNAHPERLLPPMLRLPANANELGKKV 395

Return to query results.
Submit another query.