DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and LOC1274229

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_061501508.1 Gene:LOC1274229 / 1274229 VectorBaseID:AGAMI1_001999 Length:1390 Species:Anopheles gambiae


Alignment Length:53 Identity:16/53 - (30%)
Similarity:24/53 - (45%) Gaps:15/53 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LLLSTEPPVPVVYFDKNYIGNVSSETILNTIEFLESFLPPPTKKHKRKNRVRG 206
            |.||.:|            |....||||::.|:.:..||..|   :||.::.|
Mosquito    10 LTLSVQP------------GQSQVETILDSSEYDDLGLPTVT---ERKGQMAG 47

Return to query results.
Submit another query.