DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Cel

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_034015.1 Gene:Cel / 12613 MGIID:88374 Length:599 Species:Mus musculus


Alignment Length:43 Identity:14/43 - (32%)
Similarity:19/43 - (44%) Gaps:6/43 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RKIALHILPLFLAIF--LFTMGEA----YLKSVRVDEIPFAGR 41
            ||...|.||:.:.|:  .|.||..    :||:...|....|.|
Mouse   111 RKQVSHNLPVMVWIYGGAFLMGSGQGANFLKNYLYDGEEIATR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
CelNP_034015.1 COesterase 26..542 CDD:395084 14/43 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..599
4 X 11 AA tandem repeats, O-glycosylated region 559..588
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.