DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and Ces1d

DIOPT Version :9

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_444430.2 Gene:Ces1d / 104158 MGIID:2148202 Length:565 Species:Mus musculus


Alignment Length:208 Identity:40/208 - (19%)
Similarity:72/208 - (34%) Gaps:57/208 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRRKIALHILPLFLAIFLFTMG------EAY--LKSVRVDEI--PFAGRKALANRRSSGIHLISS 57
            ||:|....:|...|.:.||.:.      |:|  |.:| :|.:  |.|..:.||.:..|       
Mouse   285 LRQKTEDELLETSLKLNLFKLDLLGNPKESYPFLPTV-IDGVVLPKAPEEILAEKSFS------- 341

  Fly    58 LEHQRTFLHLFHVPYIICFYAAKGKWPYVPGFMKYRVDNAARSFFNQNDSFIKQFCTKWIQVKEC 122
                       .||||:.....:..| .:|..|.|.:..........|....|.:.|  :::.|.
Mouse   342 -----------TVPYIVGINKQEFGW-IIPTLMGYPLAEGKLDQKTANSLLWKSYPT--LKISEN 392

  Fly   123 FRPLF---------DKSNNTDVEVETLDAKIQGQRCNCDKLLLSTEPPVPVVYFDKNYIGNVSSE 178
            ..|:.         |.:...|:..:.:...:.|               ||.|...::: .:..:.
Mouse   393 MIPVVAEKYLGGTDDLTKKKDLFQDLMADVVFG---------------VPSVIVSRSH-RDAGAS 441

  Fly   179 TILNTIEFLESFL 191
            |.:...|:..||:
Mouse   442 TYMYEFEYRPSFV 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
Ces1dNP_444430.2 COesterase 24..545 CDD:278561 40/208 (19%)
Aes <121..>239 CDD:223730
Prevents secretion from ER. /evidence=ECO:0000255 562..565
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.