DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30095 and nlgn1

DIOPT Version :10

Sequence 1:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_017213657.1 Gene:nlgn1 / 100002610 ZFINID:ZDB-GENE-090918-1 Length:867 Species:Danio rerio


Alignment Length:122 Identity:22/122 - (18%)
Similarity:40/122 - (32%) Gaps:49/122 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 DKSNNTDVEVETLDAKIQGQRCNCDKLLLST-------------------EPPVPVVYFDK---- 169
            :|.:.||..|.|...|::|.:...:..:|..                   :||.|.:.:.:    
Zfish    47 EKLDETDPIVTTTYGKVRGFKKELNNEILGPVIQFLGVPYAAPPTGERRFQPPEPPISWSEIRNA 111

  Fly   170 NYIGNVSSETIL--------------NTIEFLESFLPP------------PTKKHKR 200
            .....|..:|:|              |:||.:.|::..            ||:..||
Zfish   112 TQFAPVCPQTLLEGRLPDVMLPVWFTNSIEVVSSYVQDQSEDCLFLNIYVPTEDVKR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30095NP_725529.1 None
nlgn1XP_017213657.1 COesterase 53..647 CDD:395084 20/116 (17%)

Return to query results.
Submit another query.