DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6AL and cox6a2

DIOPT Version :9

Sequence 1:NP_725504.1 Gene:COX6AL / 246451 FlyBaseID:FBgn0050093 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001004884.1 Gene:cox6a2 / 448222 XenbaseID:XB-GENE-5784173 Length:105 Species:Xenopus tropicalis


Alignment Length:77 Identity:39/77 - (50%)
Similarity:49/77 - (63%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ANTAGLWKRVTFLLALPAIVLCAANAFTGHKH--VEREPFAKYEYLRRRTKRFPWGDGNRSLFHN 76
            |..|..||.::|.:|||.:.:|..||:...:|  .||..|..|::||.|||||||||||.|.|||
 Frog    26 AKAARTWKILSFTVALPGVAVCMLNAWLKKQHHPHERPKFVAYDHLRIRTKRFPWGDGNHSFFHN 90

  Fly    77 AEVNALPEGYED 88
            ...|.||.|||:
 Frog    91 PHANPLPAGYEE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6ALNP_725504.1 Cyt_c_Oxidase_VIa 14..87 CDD:238465 37/74 (50%)
cox6a2NP_001004884.1 Cyt_c_Oxidase_VIa 15..101 CDD:238465 37/74 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47989
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.