DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6AL and cox6a2

DIOPT Version :9

Sequence 1:NP_725504.1 Gene:COX6AL / 246451 FlyBaseID:FBgn0050093 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001004680.1 Gene:cox6a2 / 447942 ZFINID:ZDB-GENE-040912-129 Length:103 Species:Danio rerio


Alignment Length:81 Identity:40/81 - (49%)
Similarity:50/81 - (61%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GNMPANTAGLWKRVTFLLALPAIVLCAANAF---TGHKHVEREPFAKYEYLRRRTKRFPWGDGNR 71
            |:.....|..||.::|:||||.:.:|.||.:   ..|.| |:..|..|.:||.|||.:||||||.
Zfish    20 GSHEGGGARTWKILSFVLALPGVSVCMANVYLKMQAHSH-EQPEFVPYPHLRIRTKPWPWGDGNH 83

  Fly    72 SLFHNAEVNALPEGYE 87
            |||||...||||.|||
Zfish    84 SLFHNPHTNALPTGYE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6ALNP_725504.1 Cyt_c_Oxidase_VIa 14..87 CDD:238465 37/75 (49%)
cox6a2NP_001004680.1 Cyt_c_Oxidase_VIa 15..99 CDD:238465 38/79 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47989
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.