DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6AL and cox6a1

DIOPT Version :9

Sequence 1:NP_725504.1 Gene:COX6AL / 246451 FlyBaseID:FBgn0050093 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001005592.1 Gene:cox6a1 / 335774 ZFINID:ZDB-GENE-030131-7715 Length:108 Species:Danio rerio


Alignment Length:78 Identity:41/78 - (52%)
Similarity:54/78 - (69%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NTAGLWKRVTFLLALPAIVLCAANAFTGHKHVEREP-FAKYEYLRRRTKRFPWGDGNRSLFHNAE 78
            |.|..||.:||::|||.:.:|..|.:...:|...:| |..|.:||.|:|||||||||::||||..
Zfish    31 NAAKTWKILTFVVALPGVAVCMLNMYLRSQHHHEQPEFVPYSHLRIRSKRFPWGDGNKTLFHNPH 95

  Fly    79 VNALPEGYE--DE 89
            |||||:|||  ||
Zfish    96 VNALPDGYEHHDE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6ALNP_725504.1 Cyt_c_Oxidase_VIa 14..87 CDD:238465 37/72 (51%)
cox6a1NP_001005592.1 Cyt_c_Oxidase_VIa 24..104 CDD:238465 37/72 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47989
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.