DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6AL and cox13

DIOPT Version :9

Sequence 1:NP_725504.1 Gene:COX6AL / 246451 FlyBaseID:FBgn0050093 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_588417.1 Gene:cox13 / 2538807 PomBaseID:SPCC1739.09c Length:130 Species:Schizosaccharomyces pombe


Alignment Length:78 Identity:32/78 - (41%)
Similarity:50/78 - (64%) Gaps:12/78 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WKRVTFLLALPAIVLCAANAFTGH-------KHVE-REPFAKYEYLRRRTKRFPWGDGNRSLFHN 76
            ||:||:.:..||::|.:|||:..:       |||| .:|...:|.|  |.|::|||||:::||.|
pombe    57 WKKVTYYIGGPALILASANAYYIYCKHQEHAKHVEDTDPGYSFENL--RFKKYPWGDGSKTLFWN 119

  Fly    77 AEVNALPEGYEDE 89
            .:||.|.:  :||
pombe   120 DKVNHLKK--DDE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6ALNP_725504.1 Cyt_c_Oxidase_VIa 14..87 CDD:238465 30/74 (41%)
cox13NP_588417.1 Cyt_c_Oxidase_VIa 42..130 CDD:238465 30/76 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3225
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2025
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 1 1.000 - - oto102105
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.