DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6AL and Cox6a1

DIOPT Version :9

Sequence 1:NP_725504.1 Gene:COX6AL / 246451 FlyBaseID:FBgn0050093 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_036946.1 Gene:Cox6a1 / 25282 RGDID:2384 Length:111 Species:Rattus norvegicus


Alignment Length:76 Identity:38/76 - (50%)
Similarity:50/76 - (65%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TAGLWKRVTFLLALPAIVLCAANAF--TGHKHVEREPFAKYEYLRRRTKRFPWGDGNRSLFHNAE 78
            :|.:||.:|:.:|||.:.:...|.|  :.|:..||..|..|.:||.|||.|||||||.:||||..
  Rat    36 SARIWKALTYFVALPGVGVSMLNVFLKSRHEEHERPEFVAYPHLRIRTKPFPWGDGNHTLFHNPH 100

  Fly    79 VNALPEGYEDE 89
            :|.||.|||||
  Rat   101 MNPLPTGYEDE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6ALNP_725504.1 Cyt_c_Oxidase_VIa 14..87 CDD:238465 34/72 (47%)
Cox6a1NP_036946.1 Cyt_c_Oxidase_VIa 24..109 CDD:238465 34/72 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352485
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47989
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.720

Return to query results.
Submit another query.