DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6AL and COX6A1

DIOPT Version :9

Sequence 1:NP_725504.1 Gene:COX6AL / 246451 FlyBaseID:FBgn0050093 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_004364.2 Gene:COX6A1 / 1337 HGNCID:2277 Length:109 Species:Homo sapiens


Alignment Length:76 Identity:39/76 - (51%)
Similarity:49/76 - (64%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TAGLWKRVTFLLALPAIVLCAANAF--TGHKHVEREPFAKYEYLRRRTKRFPWGDGNRSLFHNAE 78
            :|.:||.:||.:|||.:.:...|.:  :.|...||..|..|.:||.|||.|||||||.:||||..
Human    34 SARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPH 98

  Fly    79 VNALPEGYEDE 89
            ||.||.|||||
Human    99 VNPLPTGYEDE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6ALNP_725504.1 Cyt_c_Oxidase_VIa 14..87 CDD:238465 35/72 (49%)
COX6A1NP_004364.2 Cyt_c_Oxidase_VIa 22..107 CDD:238465 35/72 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158481
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1430
OMA 1 1.010 - - QHG47989
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.700

Return to query results.
Submit another query.