DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG34171

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:293 Identity:67/293 - (22%)
Similarity:116/293 - (39%) Gaps:67/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIPKIVGGVDAGELKNP-------WMALIKT-------NDEFICGGSVITNKFVLTAAHCMCTDE 83
            ::||.:..:.......|       ::..::|       .|...|.|.::||:.|||:|||: ||:
  Fly    14 VLPKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCI-TDK 77

  Fly    84 ECIVKYTQLTVTLGVYHLLATGE--------HN---HPHEIYNVERVYIHDSFAIQNYRNDIALL 137
            ..::...:..|......|..|.|        ||   ||         |.|     :|..||||::
  Fly    78 NGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHP---------YYH-----RNQHNDIAII 128

  Fly   138 RLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKM------SNNLQMVKIYRID 196
            :|::.:..........:|.|..|:...|.    ..|| |:.|..:.      |..|..|::...|
  Fly   129 KLKRYVKLDGHHLAPVVLGNSSLEVGNDC----KTIG-GIFGVRRQRFGSFHSMLLVNVELRPFD 188

  Fly   197 -----RKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTED 256
                 :|...||.....|  :.|. .:..:..|..|.||||:.    ||......||.::..:.|
  Fly   189 ECLKVKKSLMAARPENED--LICV-KSTEKQMCTTDFGGPLFC----DGQLYGIALGSINCSSPD 246

  Fly   257 CRGFGMYTDVMGHIDFIERIVLDADIEVVLPYI 289
            .   ..::||..:..::.:|:.:| ::...|:|
  Fly   247 P---VFFSDVSFYNSWVTKIISEA-VDHTRPFI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 62/272 (23%)
Tryp_SPc 37..276 CDD:238113 61/274 (22%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 61/260 (23%)
Tryp_SPc 38..263 CDD:304450 60/254 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.