DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Prss21

DIOPT Version :10

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:102 Identity:20/102 - (19%)
Similarity:41/102 - (40%) Gaps:12/102 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 EAFCAKLETLTGRSADAVNVF--PELKLLTLGIICETAMGVGMDGEGQSTQQAYYTQIVEELSSI 209
            :|....:..||..|...||.:  .:.:::.:|.:||...|...|.:..:.....:..:  ..|::
Mouse    37 QAISTNINDLTQDSIKTVNKYCSADDQIVHMGWVCEQTAGADADRDADAAHCCRFLAL--RGSAL 99

  Fly   210 LYWR----MFNVFVNIDAVFRLTRTSRRFDELVKKSW 242
            |.:|    :.:.:...:|.|.|.....:    |.|.|
Mouse   100 LIFRTPPILASDWTQAEASFHLCEVLFK----VHKLW 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 20/102 (20%)
Tryp_SPc 332..520 CDD:473915
Prss21NP_065233.2 Tryp_SPc 55..294 CDD:238113 15/84 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.