DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and prss8

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001016980.1 Gene:prss8 / 549734 XenbaseID:XB-GENE-5758112 Length:329 Species:Xenopus tropicalis


Alignment Length:329 Identity:87/329 - (26%)
Similarity:143/329 - (43%) Gaps:59/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KIVGGVDAGELKNPWMALIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYH 100
            :||||.||.|...||.|.::.:...:||.::|:..|::|||||..:|.. :|.|   :|.|||..
 Frog    29 RIVGGHDASEGMFPWQASLRYDGNHVCGAALISANFIVTAAHCFPSDHS-LVGY---SVYLGVLQ 89

  Fly   101 LLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTD 165
            |   |..:...::..:::|.|:.|::......|:|:..|.....:...::|:.:   .....|..
 Frog    90 L---GVPSSNSQLLKLKQVTIYPSYSHDTSSGDLAVAALDSPATFSHVVQPISL---PAANVQFP 148

  Fly   166 LIQEFTAIGWGVTGNG---KMSNNLQMVKIYRIDRKMCEAAF--------WYTFDYPMFCAGTAV 219
            :.......|||....|   ..:.|||:..:..|.|:.|...:        ..:....|.|||:|.
 Frog   149 IGMTCQVTGWGNIQQGVNLPGAKNLQVGNVKLIGRQTCNCLYNIKPSADSMGSIQPDMICAGSAA 213

  Fly   220 GR-DTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGF---GMYTDVMGHIDFIERIVLDA 280
            |. |.|:.||||||...:  :|  :|....:||.| ::|...   |:|..:..:..:|:.|...|
 Frog   214 GSVDACQGDSGGPLTCTV--NG--KAYLAAVVSWG-DECGAQNKPGVYILISAYASWIQGIDPSA 273

  Fly   281 ---DIEVVLPYIDLLDAGCLGNDTLNSWDRSGPDAIRSFEWLAEVYKDSFIISNGALISKTFVVT 342
               ...|.:|.....|:||:|.:                   .:.|.:    .|||.|   |:||
 Frog   274 VFQSFTVDIPSEPENDSGCIGAN-------------------GQFYPN----PNGAAI---FLVT 312

  Fly   343 TAQL 346
            .|.|
 Frog   313 VAAL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 68/251 (27%)
Tryp_SPc 37..276 CDD:238113 69/253 (27%)
Trypsin 310..520 CDD:278516 10/37 (27%)
Tryp_SPc 313..520 CDD:304450 10/34 (29%)
prss8NP_001016980.1 Tryp_SPc 29..266 CDD:214473 68/251 (27%)
Tryp_SPc 30..269 CDD:238113 69/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.