DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:111/270 - (41%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QLIP----------KIVGGVDAGELKNPWMA--LIKTNDEFICGGSVITNKFVLTAAHCMCTDEE 84
            :|:|          :|..|..|.|.|.|::.  |...|..:.||||:|.|.:|||||||......
  Fly    23 KLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASG 87

  Fly    85 CIVKY-------TQLTVTLGVYHLLATG---EHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRL 139
            ..:.|       .|.|      |.:.:|   :|:|    ||           ..|..|||:|:| 
  Fly    88 VTINYGASLRNQPQYT------HWVGSGNFVQHHH----YN-----------SGNLHNDISLIR- 130

  Fly   140 QKSIVYKPQIKPLCILLNDQLKPQTDLIQEF-----TAIGWGVTGNGK-MSNNLQMVKIYRIDRK 198
                  .|.:....::...:|....|..|::     .|.|||.|.:|. :.:.||.|.:..:.:.
  Fly   131 ------TPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQS 189

  Fly   199 MCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMY 263
            .|... |...| .|.|..|..|:.||..||||||..|   :|.:.......||:.........::
  Fly   190 DCSRT-WSLHD-NMICINTNGGKSTCGGDSGGPLVTH---EGNRLVGVTSFVSSAGCQSGAPAVF 249

  Fly   264 TDVMGHIDFI 273
            :.|.|::|:|
  Fly   250 SRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 71/254 (28%)
Tryp_SPc 37..276 CDD:238113 72/255 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 71/254 (28%)
Tryp_SPc 38..262 CDD:238113 72/255 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.