DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG9737

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:299 Identity:85/299 - (28%)
Similarity:136/299 - (45%) Gaps:69/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLDEDCGVPMQLIPKIVGGVDAGELKN-PWMALIKTN-DEFICGGSVITNKFVLTAAHC------ 78
            ||:| ||  .|:..:|.|| :..||.. ||:||:..| :::.|.|::|.::.:||||||      
  Fly   138 LLNE-CG--KQVTNRIYGG-EIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGV 198

  Fly    79 ---------------MCTDEECIVKYTQLT---VTLGVYHLLATGEHNHPHEIYNVERVYIHDSF 125
                           :.|:.:||.:...|:   ..|.:.:                |::::|..:
  Fly   199 RDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAY----------------EKIHVHPEY 247

  Fly   126 -AIQNYR-NDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLI--QEFTAIGWGVTG-NGKMSN 185
             ...||: ||||::||:..:.:...:.|:|  |.::.:|.| |.  |.|:..|||.|. ..|...
  Fly   248 KEFSNYKYNDIAIIRLKHPVSFTHFVMPIC--LPNKSEPLT-LAEGQMFSVSGWGRTDLFNKYFI 309

  Fly   186 NLQ-----MVKIYRIDRKMCE---AAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFD-GI 241
            |:.     .::|..:..:.|.   ..|.........|||....:|||..||||||   |.|| ..
  Fly   310 NIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPL---MYFDRQH 371

  Fly   242 KRATQLGIVSTGTEDCRGFG---MYTDVMGHIDFIERIV 277
            .|....|:||.|...|...|   :||:|..:.|:|:.:|
  Fly   372 SRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 77/279 (28%)
Tryp_SPc 37..276 CDD:238113 78/281 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 77/279 (28%)
Tryp_SPc 150..409 CDD:238113 78/281 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.