DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:255 Identity:65/255 - (25%)
Similarity:112/255 - (43%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KIVGGVDAGELKNPWMALIKTNDE---FICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLG 97
            :|..|..|.|.:.|::..:..|..   :.||||:|.:.:|||||||....:|..:.|..:.....
  Fly    40 RITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEP 104

  Fly    98 VYHLLATGEH--NHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQK----SIVYKPQIKPLCILL 156
            .:....:.|:  .:||.:               ...:|:||::...    |:|.|.::..|....
  Fly   105 AFRHTVSSENFIRYPHYV---------------GLDHDLALIKTPHVDFYSLVNKIELPSLDDRY 154

  Fly   157 NDQLKPQTDLIQEFTAIGWGVTGNG-KMSNNLQMVKIYRIDRKMCEAAFWY---TFDYPMFCAGT 217
            |..   :.:.:|   |.|||...:| .:..:|::|.:..|....|:|  :|   |......|..|
  Fly   155 NSY---ENNWVQ---AAGWGAIYDGSNVVEDLRVVDLKVISVAECQA--YYGTDTASENTICVET 211

  Fly   218 AVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVS-TGTEDCR--GFGMYTDVMGHIDFIE 274
            ..|:.||:.||||||   :..:|.|   .:||.| .....|:  |...:|.|..::::|:
  Fly   212 PDGKATCQGDSGGPL---VTKEGDK---LIGITSFVSAYGCQVGGPAGFTRVTKYLEWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 64/252 (25%)
Tryp_SPc 37..276 CDD:238113 65/254 (26%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 64/252 (25%)
Tryp_SPc 41..266 CDD:238113 65/254 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.