DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:253 Identity:76/253 - (30%)
Similarity:112/253 - (44%) Gaps:45/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KIVGGVDAGELKNPWMA--LIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGV 98
            :|..|..|.|.|.|::.  |...|..:.||||:|.|.:|||||||........:.|.....|...
  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQ 99

  Fly    99 Y-HLLATG---EHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQ 159
            | |.:.:|   :|:|    ||           ..|..|||:|:|       .|.:....::...:
  Fly   100 YTHWVGSGDIIQHHH----YN-----------SGNLHNDISLIR-------TPHVDFWSLVNKVE 142

  Fly   160 LKPQTDLIQEF-----TAIGWGVTGNGK-MSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTA 218
            |....|..|::     .|.|||.|.:|. :.:.||.|.:..|.:..|... |...| .|.|..|.
  Fly   143 LPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRT-WSLHD-NMICINTD 205

  Fly   219 VGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGT-EDCRGF--GMYTDVMGHIDFI 273
            .|:.||..||||||..|   ||.:   .:|:.|.|: ..|:..  .:::.|.|::|:|
  Fly   206 GGKSTCGGDSGGPLVTH---DGNR---LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 75/251 (30%)
Tryp_SPc 37..276 CDD:238113 76/252 (30%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 76/252 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.