DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG11841

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:116/270 - (42%) Gaps:58/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKIVGGVDAGELKNPWMALI---KTNDE--FICGGSVITNKFVLTAAHCMCTD--EECIVKYTQL 92
            |.||.|..|...:.|:.|.:   |||:|  :.|||::|:|:.|||||||..::  |..:|:..:|
  Fly    70 PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGEL 134

  Fly    93 TVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLN 157
            .        ..|...:...|.:.|..:..|..|......|||.:::|.:.:.:.....|.|:..:
  Fly   135 E--------FDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFD 191

  Fly   158 DQLKPQTDLIQEFTAIGWGVTGNG-KMSNNLQMVKI--YRIDRKMCEAAFWYTFDYP-------M 212
            |     .:..:.|.|||||..... |.|..|..|::  |: ||  |.::.....:.|       .
  Fly   192 D-----GEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYK-DR--CVSSVDANDELPNGYEPKSQ 248

  Fly   213 FCAGTAVGRDTCKRDSGGPL---------YIHMLFDGIKRATQLGIVSTG----TEDCRGFGMYT 264
            .|.|:...:|||..|||||:         ..|:          :||.|.|    |.|..  ..||
  Fly   249 LCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHV----------MGITSAGITCSTPDIP--SAYT 301

  Fly   265 DVMGHIDFIE 274
            .|...:::|:
  Fly   302 RVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 72/266 (27%)
Tryp_SPc 37..276 CDD:238113 73/268 (27%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 72/266 (27%)
Tryp_SPc 72..310 CDD:214473 72/265 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.