DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG5909

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:260 Identity:82/260 - (31%)
Similarity:126/260 - (48%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKIVGGVDAGELKNPWMALI--KTND--EFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVT 95
            ||:.||..|.....||:||:  |.||  .|.||||:|:.:.:||||||:....|.|      .|.
  Fly   128 PKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVI------AVR 186

  Fly    96 LGVYHLLATGEHNH-----------PHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQI 149
            || .|.|.:.|..|           |:|.|.:|::.:|.::......:|:|:::|.:.:..|..|
  Fly   187 LG-EHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSHI 250

  Fly   150 KPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWY----TFDY 210
            ||:|:.: ||...:.|..|.|...|||.|....::..||...|.|  :.:.|...:|    ..|.
  Fly   251 KPVCLPI-DQKSQELDFDQSFFVAGWGGTEKETVATKLQQALITR--KSLNECRQYYNKGEVSDN 312

  Fly   211 PMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDC--RGFGMYTDVMGHIDFI 273
            .:...||.: :.||:.|||||::....|....|..|.|:||.|...|  ...|::..|:..:.:|
  Fly   313 HICATGTGI-KHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDMLPWI 376

  Fly   274  273
              Fly   377  376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 80/257 (31%)
Tryp_SPc 37..276 CDD:238113 80/258 (31%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 80/257 (31%)
Tryp_SPc 132..379 CDD:238113 80/256 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.