DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and grass

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:283 Identity:81/283 - (28%)
Similarity:129/283 - (45%) Gaps:53/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DE--DCGVPMQLIPKIVGGVDAGELKNPWMALIK----TNDEFICGGSVITNKFVLTAAHC---- 78
            ||  |||  ..|..::..|.:......|||||::    ....|:|||::|:.:::||||||    
  Fly   106 DENFDCG--NFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGL 168

  Fly    79 -------------MCTDEEC-----IVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSF 125
                         :.|:|:|     ..|.....|.:|                  :|:..||:.:
  Fly   169 QNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPVVNVG------------------IEKHLIHEKY 215

  Fly   126 AIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMV 190
            ..::..:|||||:|.:|:.::..|||:|:.:.|:||.:.:.|..:...|||.|.||..|:.|...
  Fly   216 DARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQA 280

  Fly   191 KIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDG--IKRATQLGIVSTG 253
            .:....|..|..|:.........|.|....:|:||.||||||.....:.|  ..:..:.||||.|
  Fly   281 NVPLQPRSACSQAYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQG 345

  Fly   254 TEDCRGF---GMYTDVMGHIDFI 273
            ...|...   |:||:|..::.:|
  Fly   346 VVTCGQISLPGLYTNVGEYVQWI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 74/267 (28%)
Tryp_SPc 37..276 CDD:238113 75/268 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 75/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.