DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and SPE

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:287 Identity:81/287 - (28%)
Similarity:128/287 - (44%) Gaps:55/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CGVPMQLIPKIVGGVDAGELKNPWMALIKTND------EFICGGSVITNKFVLTAAHCMCTDEEC 85
            ||  .....:|.||.:....:.|||.|::...      .|.|||:::.:::||||.||:.:.|  
  Fly   127 CG--FLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRE-- 187

  Fly    86 IVKYTQLTVTLGVYHLLATGE---HNHP---------------HEIYNVERVYIHDSFAIQ--NY 130
                  |..:..|.|.:..||   ...|               |....||:..||:.:|..  :.
  Fly   188 ------LDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQ 246

  Fly   131 RNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQE------FTAIGWGVTGNGKMSNNLQM 189
            ||||||:||::.:.|...::|:|:       |...|:|.      ....|||:|.|.:.|.....
  Fly   247 RNDIALVRLKRIVSYTDYVRPICL-------PTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLK 304

  Fly   190 VKIYRIDRKMCE---AAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVS 251
            :.:...:...|:   ::|....|....|||..:|.|||..||||||.:.:...|.......|:.|
  Fly   305 ITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTS 369

  Fly   252 TGTEDC--RGF-GMYTDVMGHIDFIER 275
            .||:.|  :|: |:||.....||:|::
  Fly   370 YGTKPCGLKGWPGVYTRTGAFIDWIKQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 78/274 (28%)
Tryp_SPc 37..276 CDD:238113 79/277 (29%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 79/277 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463562
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.