DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG16710

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:294 Identity:84/294 - (28%)
Similarity:117/294 - (39%) Gaps:75/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CGVPMQLIPKIVGGVDAGELKNPWMALI--------KTNDEFI--CGGSVITNKFVLTAAHCM-- 79
            || |:....:|.||.:....:.||||||        ..|:..:  |.||:|||::|||||||:  
  Fly    97 CG-PIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRI 160

  Fly    80 --------------------CTD-----EECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERV 119
                                |..     |.|..::.::.|.|.:         .|.|.:...||.
  Fly   161 TGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSI---------KHRHYMVFEERP 216

  Fly   120 YIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMS 184
            |           ||||||||:..:.|..||||:|:.|:......:....:....|||::.....|
  Fly   217 Y-----------NDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYS 270

  Fly   185 NNLQMVKIYRIDRKMCEAAFWYTFDYPM--------FCAGTAVGRDTCKRDSGGPLYIHMLFDGI 241
            |.|....:...:...|      :...|.        .|||...|.||||.||||||...|.....
  Fly   271 NVLLQAYVNGRNADEC------SLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDE 329

  Fly   242 KRATQLGIVSTGTEDCRGFG--MYTDVMGHIDFI 273
            :.....||.|.|...| |:|  .||.....:::|
  Fly   330 EFVYLAGITSYGYSQC-GYGPAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 80/283 (28%)
Tryp_SPc 37..276 CDD:238113 81/284 (29%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 80/283 (28%)
Tryp_SPc 106..362 CDD:238113 80/282 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.