DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG31199

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:202 Identity:48/202 - (23%)
Similarity:78/202 - (38%) Gaps:67/202 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SARLLDEDCG-------VPMQ---LIPKIVGGVDAGELKNPWMALI--------KTNDEFICGGS 65
            ||::.|:.||       :.||   .||          .::.|:|.|        |..|.. |.|.
  Fly    21 SAKVNDDQCGAFDEDQMLNMQSTFAIP----------TEHQWVARIVYGKGFEGKIRDNG-CLGV 74

  Fly    66 VITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHN-----------------HPHEI 113
            :::.:.||..||       |.|:|..:.....| ||   |.||                 .|.:.
  Fly    75 LVSKRTVLAPAH-------CFVQYNGVAEAFSV-HL---GVHNKSAPVGVRVCETDGYCVRPSQE 128

  Fly   114 YNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCI----LLNDQLKPQTDLI------Q 168
            ..:..:.||..:..:..:|.:|:|.||:.....|.:.|:|:    |||:.|..||.::      :
  Fly   129 IKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFE 193

  Fly   169 EFTAIGW 175
            :|....|
  Fly   194 DFRLKTW 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 39/175 (22%)
Tryp_SPc 37..276 CDD:238113 39/174 (22%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 41/178 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.