DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG31219

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:311 Identity:89/311 - (28%)
Similarity:136/311 - (43%) Gaps:67/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AWMLTAGR------GSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALI----KTNDEFI--C 62
            ||:|...|      |:.....|.||..:... ::|||.:|.....||||::    .|..|.:  |
  Fly    57 AWLLFGQRICCPPPGNRLPSTEICGQSLSTY-RMVGGSEARPNGYPWMAMLLYLNTTTLEILPFC 120

  Fly    63 GGSVITNKFVLTAAHCM-CTDEECIVKYTQLTVTLGVYHLLATGEHNHPHE-IYN---------- 115
            .||:|.|::|||:|||: ....:..:|..:|            |||:..:: .||          
  Fly   121 AGSLINNRYVLTSAHCVNGIPRDLSLKSVRL------------GEHDITYDPAYNPDCRDQDNQC 173

  Fly   116 --------VERVYIHDSFAIQNYRN---DIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLI-- 167
                    :|::.:|..|:..:.||   |||||||:..:.|:..|.|:||       |:....  
  Fly   174 ALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICI-------PKHGFFAK 231

  Fly   168 QEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYP---MFCAGTAVGRDTCKRDSG 229
            .:....|||.|..|:.|..|....|......:|...|.| .|..   ..|||...|.|||:.|||
  Fly   232 SKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPY-LDLNQSLQICAGGYDGVDTCQGDSG 295

  Fly   230 GPLYIHMLFDGIKRATQLGIVSTGTEDCRGF---GMYTDVMGHIDFIERIV 277
            |||.:.|....:..|   ||.:.|:::|...   |:||.....:.:|:.::
  Fly   296 GPLMVTMDNSSVYLA---GITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 80/273 (29%)
Tryp_SPc 37..276 CDD:238113 81/275 (29%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 80/273 (29%)
Tryp_SPc 90..342 CDD:238113 81/274 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.