DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG31265

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:286 Identity:61/286 - (21%)
Similarity:106/286 - (37%) Gaps:68/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KIVGGVDAGELKNPWMALIKTNDE------------------FICGGSVITNKFVLTAAHCMCTD 82
            :|||...||:     ...||..:|                  ..|||:::...:::||.|     
  Fly    24 RIVGPFPAGQ-----SGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGH----- 78

  Fly    83 EECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKP 147
              |:..:....|.:    :..|.:...|..||....::.|..:......|||||::|.::|.:..
  Fly    79 --CVENFIPALVNV----ITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNE 137

  Fly   148 QIKPLCILLNDQLKPQTDLIQEFTAIGWGV-TGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYP 211
            ..:|:.:    ..:| ..|.:|....|||. ...|....:|..:.:..:....|...|..|....
  Fly   138 LTQPIAL----PTRP-VQLGEEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYETFNRTSSMG 197

  Fly   212 M--FCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGHIDFIE 274
            :  .|..:..|...|..||||||        :.....:|:|:.| ..| |.|: .||..::.:  
  Fly   198 VGHICTFSREGEGACHGDSGGPL--------VSNGQLVGVVNWG-RPC-GVGL-PDVQANVYY-- 249

  Fly   275 RIVLDADIEVVLPYIDLLDAGCLGND 300
                         |:|.:.:...||:
  Fly   250 -------------YLDWIRSKLSGNN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 57/257 (22%)
Tryp_SPc 37..276 CDD:238113 57/259 (22%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 54/259 (21%)
Tryp_SPc 39..257 CDD:238113 52/259 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.