DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG3505

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:350 Identity:81/350 - (23%)
Similarity:125/350 - (35%) Gaps:114/350 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 VMGH------IDFIERIVLDA--------------------DIEVVLPYIDLLDAGCLGNDTLNS 304
            |.||      .|:..||:|..                    |::|..|  .....|.|.:..|.|
  Fly    36 VTGHCISIRECDYFMRILLSGNLSQSDRNLLRDNQCGVRGNDVQVCCP--STAGLGALTHPLLPS 98

  Fly   305 ------WDRSG--PDAIRSFEWLAEV-----YKDSFIISNGALISKTFVVTTAQLISESTALKVQ 356
                  |.||.  ...||.|.|||.:     .::......|.|||..:|:|.|..::::....:|
  Fly    99 DCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQ 163

  Fly   357 -----LGQGDVHTYAVASVHKHPKFVSLAQ------------------------NDIALLKLGEE 392
                 ||:.|..|......|:..|....|.                        |||||::|...
  Fly   164 ITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASP 228

  Fly   393 VQYTESIRPICLPSLSNKAEQQKFQRRAADPALNLI--AVGWGTPTNVVVRRTNASKCYREDHQD 455
            .:..:.::|||||:          ::..||...:|:  ..||         :.::|:..|:.:..
  Fly   229 AKLNDFVQPICLPN----------KQLRADELEDLVTEVAGW---------QASSSQRMRKGYVT 274

  Fly   456 IGEQQLCMESPSPHLLRV----------------GIGSPLVNPLTHGNRRAFSLVGLASFGRL-- 502
            |...:.|....:...||:                ..|.||:.....|    :.|.||.|||.:  
  Fly   275 ISSIEECQRKYASQQLRIQASKLCGLTNSQECYGNAGGPLMLFKNDG----YLLGGLVSFGPVPC 335

  Fly   503 -EPFASNVYTNVLEYLDWIGEMVKA 526
             .|...:|||.|..|:|||.:.:||
  Fly   336 PNPDWPDVYTRVASYIDWIHDSLKA 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 4/12 (33%)
Tryp_SPc 37..276 CDD:238113 4/15 (27%)
Trypsin 310..520 CDD:278516 60/264 (23%)
Tryp_SPc 313..520 CDD:304450 60/261 (23%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 9/45 (20%)
Tryp_SPc 111..356 CDD:238113 62/267 (23%)
Tryp_SPc 111..354 CDD:214473 60/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.