DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG9649

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:273 Identity:79/273 - (28%)
Similarity:111/273 - (40%) Gaps:63/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKIVGGVDAGELKNPWMAL----IKTNDEFICGGSVITNKFVLTAAHCM------CTDEECIVKY 89
            |.|..|::....:.||||.    :..:..|:|||::|:.:.|::||||.      ...|..||..
  Fly   255 PFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSL 319

  Fly    90 TQLTV-------TLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKP 147
            .:.::       ||||..||.       ||.|| ..||. |:        |:|||:|...:....
  Fly   320 GRNSLDLFSSGATLGVARLLI-------HEQYN-PNVYT-DA--------DLALLQLSNHVDIGD 367

  Fly   148 QIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNL-QMVKIYRIDRKMC------EAAFW 205
            .|||:| |.|:....:.....:....|||....|..:..| :|.....|.:..|      |.|.:
  Fly   368 YIKPIC-LWNENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKF 431

  Fly   206 YTFDYPMFCAGTAVGRDTCKRDSGGPLY-----IHMLFDGIKRATQLGIVSTG---TEDCRGF-- 260
            .|..  ..||..|.....|..||||.|.     |.||         .|:||.|   |..|...  
  Fly   432 ITSH--TICASNAQASGPCSGDSGGGLMLQEQDIWML---------RGVVSAGQRMTNRCNLTLP 485

  Fly   261 GMYTDVMGHIDFI 273
            .:||||..||:::
  Fly   486 VIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 78/270 (29%)
Tryp_SPc 37..276 CDD:238113 78/271 (29%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 78/269 (29%)
Tryp_SPc 259..497 CDD:214473 77/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm50645
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.