DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG8870

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:238 Identity:71/238 - (29%)
Similarity:108/238 - (45%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PWMALI----KTN--DEFI--CGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATG 105
            ||||::    |.|  .:.:  ||||:|.|.:|||||||:   |...:.|.....|:.:      |
  Fly    96 PWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCV---EYPFMDYPYALKTVRL------G 151

  Fly   106 EHN---HPHE-----------IY---NVERVYIHDSF-AIQNYRNDIALLRLQKSIVYKPQIKPL 152
            |||   :|..           :|   .|:::..|:.| ..:...|||||:||:..:.|...|:|:
  Fly   152 EHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPI 216

  Fly   153 CILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPM---FC 214
            |:....:|....   ::|.|.||...|.|..|..|....|......:|::    .:|:.:   .|
  Fly   217 CLPRAQKLAAHK---RKFQASGWPDMGQGIASEVLLRSFIAERHPDVCKS----NYDFNLGSQIC 274

  Fly   215 AGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDC 257
            ||...|.||...||||||...::...:......||:|.|.:.|
  Fly   275 AGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPC 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 71/238 (30%)
Tryp_SPc 37..276 CDD:238113 71/238 (30%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 71/238 (30%)
Tryp_SPc 93..337 CDD:214473 71/238 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.