DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and snk

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:269 Identity:82/269 - (30%)
Similarity:123/269 - (45%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IPKIVGGVDAGELKNPWMALI--------KTND-EFICGGSVITNKFVLTAAHCMCTDEECIVKY 89
            :|.||||........|.||.:        |..| ::.|||::::..:|||||||..:..:     
  Fly   183 VPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSK----- 242

  Fly    90 TQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCI 154
            ....|.||...|   .|.:...:...:..:.:|..:....|.:|||||:|.:.:.:..|::|.|:
  Fly   243 PPDMVRLGARQL---NETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACL 304

  Fly   155 LLNDQLKPQTDLIQEFTAIGWGVTG-NGKMSNNLQMV-----------KIYRIDRKMCEAAFWYT 207
            ....:|:     |....|.|||.|. .|..||.|:.|           :|||.:|::.....   
  Fly   305 WQLPELQ-----IPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGII--- 361

  Fly   208 FDYPMFCAG-TAVGRDTCKRDSGGPLYIHMLFDGIK-RATQLGIVSTGTEDC---RGFGMYTDVM 267
              ...|||| ...|||||:.|||||  ||.|..... .|..:||.|.| :.|   ...|:||.:.
  Fly   362 --EGQFCAGYLPGGRDTCQGDSGGP--IHALLPEYNCVAFVVGITSFG-KFCAAPNAPGVYTRLY 421

  Fly   268 GHIDFIERI 276
            .::|:||:|
  Fly   422 SYLDWIEKI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 78/262 (30%)
Tryp_SPc 37..276 CDD:238113 80/264 (30%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 80/264 (30%)
Tryp_SPc 186..427 CDD:214473 78/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.