DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG13318

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:249 Identity:68/249 - (27%)
Similarity:104/249 - (41%) Gaps:46/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PWM-ALIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHE 112
            ||. ||:.|.|.::.||::||.:.||||||.:..     :..|...|.||.:...:|.|.....:
  Fly   175 PWQAALLTTADVYLGGGALITAQHVLTAAHKVYN-----LGLTYFKVRLGEWDAASTSEPIPAQD 234

  Fly   113 IYNVERVYIHDSFAIQNYRNDIALLRLQK--SIVYKPQIKPLCILLNDQLKPQTDLI-QEFTAIG 174
            :| :..||::.||...|.:||:|:|:|..  |:..|..:..:|:       |.|..: |.....|
  Fly   235 VY-ISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCL-------PTTSFVGQRCWVAG 291

  Fly   175 WGVT---GNGKMSNNLQMVKIYRIDRKMCEAAFWYT--------FDYPMFCAGTAVGRDTCKRDS 228
            ||..   ..|......:.|.:..|....|:||...|        ......|||...|:|.|..|.
  Fly   292 WGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDG 356

  Fly   229 GGPL--------YIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGHIDFIE 274
            |.||        |:..|.     |..:|....|..     |:|.:|..::.:|:
  Fly   357 GSPLVCTSNGVWYVVGLV-----AWGIGCAQAGVP-----GVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 67/246 (27%)
Tryp_SPc 37..276 CDD:238113 68/249 (27%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 68/249 (27%)
Tryp_SPc 169..399 CDD:214473 67/246 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.