DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and MP1

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:290 Identity:90/290 - (31%)
Similarity:134/290 - (46%) Gaps:38/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RGSARLLD--EDCGVPMQLIPKIVGGVDAGELKNPWMALIK-TNDEFI----CGGSVITNKFVLT 74
            |...:||.  .:||  .....::|||.:..:.:.||||||: |....:    ||||:|.:::|||
  Fly   118 RSGTKLLPMAPNCG--ENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLT 180

  Fly    75 AAHCMCTDEECIVKYTQLT-VTLGVYHL-----LATGEH-----NHPHEIYNVERVYIHDSFA-- 126
            ||||:    ..|....:|| |.||.:..     ...|::     |.|:..|.||....|..:.  
  Fly   181 AAHCV----SAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGN 241

  Fly   127 IQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLI---QEFTAIGWGVTGNGKMSNNLQ 188
            .::..||||||||:..:.|...|.|:|:   ..|..|.:.|   ::....|||.|.....||...
  Fly   242 SRDQLNDIALLRLRDEVQYSDFILPVCL---PTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKL 303

  Fly   189 MVKIYRIDRKMCE---AAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIV 250
            ..::..:....|.   |....|......|||...|.|:|:.||||||.:....:|.......|:|
  Fly   304 KAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVV 368

  Fly   251 STGTEDC--RGF-GMYTDVMGHIDFIERIV 277
            |.|...|  :|: |:||.|..::::||..|
  Fly   369 SYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 82/263 (31%)
Tryp_SPc 37..276 CDD:238113 84/265 (32%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 82/263 (31%)
Tryp_SPc 138..397 CDD:238113 84/265 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463570
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.