DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG7542

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:265 Identity:72/265 - (27%)
Similarity:121/265 - (45%) Gaps:26/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLDEDC-GVPM--QLIPKIVGGVDAGELKNPWMALIKT---NDEFICGGSVITNKFVLTAAHCMC 80
            ||...| .||:  .:.|.|..|..|...:.|:.|.:..   |....|||::|::.:::||||||.
  Fly     9 LLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMD 73

  Fly    81 TDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVY 145
            ..|       .:||.||..::....|......:.....:.:|.::......|||:|:||...:.:
  Fly    74 GAE-------SVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGF 131

  Fly   146 KPQIKPLCI--LLNDQLKPQTDLIQEFTAIGWG--VTGNGKMSNNLQMVKIYRIDRKMCEAAFWY 206
            ..:|:...:  .||.|. |..:.|:.| |.|||  ...:..:|..|:.|::..:...:|...:..
  Fly   132 TDRIRAASLPRRLNGQF-PTYESIRAF-ASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSG 194

  Fly   207 TFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTE-DCR-GF-GMYTDVMG 268
            .....|.|..|..|:.||..||||||    ::.....:..:|..|.||. .|: || .::|.:..
  Fly   195 AVSEKMICMSTTSGKSTCHGDSGGPL----VYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISS 255

  Fly   269 HIDFI 273
            ::|:|
  Fly   256 YLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 65/246 (26%)
Tryp_SPc 37..276 CDD:238113 66/247 (27%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 66/247 (27%)
Tryp_SPc 27..260 CDD:214473 65/245 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.