DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and Jon74E

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:285 Identity:81/285 - (28%)
Similarity:137/285 - (48%) Gaps:39/285 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVLFAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPW---MALIKTNDEFI-CGGSV 66
            :::|..:|..|| |...||...|:.    .:|.||..|...:.|:   :::.:.||.:. ||.|:
  Fly     6 ILVFLLILVQGR-SISCLDMGHGIG----GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASL 65

  Fly    67 ITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIY---NVERVYIHDSFAIQ 128
            |:::::|||||       |:.|...:|..||....||      |.::.   |.| |::|..:..|
  Fly    66 ISDRYLLTAAH-------CVEKAVAITYYLGGVLRLA------PRQLIRSTNPE-VHLHPDWNCQ 116

  Fly   129 NYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGK--MSNNLQMVK 191
            :..|||||:||.:..:....|:|:.:......:...|.:... |.|||...:..  :|:||:.| 
  Fly   117 SLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAI-ASGWGRMNDESTAISDNLRYV- 179

  Fly   192 IYRIDRKMCEAAFWYTFDYPM-FCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQL-GIVSTGT 254
             ||......:..:.|....|. .|..|..|:.||..||||||   :..|.::.|..| |:.|.|.
  Fly   180 -YRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPL---VYSDPVQNADILIGVTSYGK 240

  Fly   255 ED-C-RGF-GMYTDVMGHIDFIERI 276
            :. | :|: .::|.:..::|:|..:
  Fly   241 KSGCTKGYPSVFTRITAYLDWIGEV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 72/250 (29%)
Tryp_SPc 37..276 CDD:238113 73/252 (29%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.