DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30091 and CG11529

DIOPT Version :9

Sequence 1:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:302 Identity:71/302 - (23%)
Similarity:121/302 - (40%) Gaps:89/302 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AWVVLFAWMLT------AGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTNDEFIC 62
            |.::|..|..|      .|:.....:::   .|.|::  ::|       |..|...|      :|
  Fly    13 AVIMLMMWKPTPTDSYAVGQSKYGRIEK---FPYQVM--LIG-------KQLWRKRI------LC 59

  Fly    63 GGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIY----NVE------ 117
            ||:::..:::|||.||                |:||.|          :::|    :||      
  Fly    60 GGTLLDKRWILTAGHC----------------TMGVTH----------YDVYLGTKSVEDTEVSG 98

  Fly   118 -------RVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCI---LLNDQLKPQTDLIQEFTA 172
                   :..:|:.|..:...|||||::|.:.:.:.|:|:|..:   ..:||....:     ..|
  Fly    99 GLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMS-----VVA 158

  Fly   173 IGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHML 237
            .|||.......|:::|..::..|....| |..:......:.||........|..||||||     
  Fly   159 SGWGAMVEMTNSDSMQYTELKVISNAEC-AQEYDVVTSGVICAKGLKDETVCTGDSGGPL----- 217

  Fly   238 FDGIKRATQL--GIVSTGTED-CRGF--GMYTDVMGHIDFIE 274
               :.:.||:  ||.|.|..| |...  |.:|.|..::|:||
  Fly   218 ---VLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 62/261 (24%)
Tryp_SPc 37..276 CDD:238113 64/263 (24%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 66/278 (24%)
Tryp_SPc 37..255 CDD:214473 64/275 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.